PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00000241-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 299aa    MW: 34438.2 Da    PI: 7.8603
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00000241-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.31.3e-082182561854
                            HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            +F++  ++yp+ +e+  LA k gLt +qV++WF N R +
  SMil_00000241-RA_Salv 218 MFQNflHPYPKDSEKHLLALKSGLTRNQVSNWFINARVR 256
                            6887779******************************88 PP

2BELL67.42.8e-2292160372
                   BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                            + l++k+ +Ll ll++Vd++Y+q+ ++++tv s+F+av++l++ ++++++ l +iS+ +++L+++i++++
  SMil_00000241-RA_Salv  92 TSLEAKRKHLLALLQMVDDQYSQCLDEIHTVTSAFHAVTELEP-NLHARFVLPTISFMYKSLRERISSHV 160
                            57899**************************************.**********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.4E-1931158IPR006563POX domain
PfamPF075265.0E-2237157IPR006563POX domain
PROSITE profilePS5007110.997197260IPR001356Homeobox domain
SMARTSM003892.0E-4200264IPR001356Homeobox domain
CDDcd000863.37E-9200261No hitNo description
SuperFamilySSF466893.8E-15201268IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.1E-25203265IPR009057Homeodomain-like
PfamPF059202.2E-14217256IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MSCSNGVTSC YSLPEHTSCS SKNPSSGFKP LQLPPLLSGS RFLEAMQEIL AEIACYALES  60
NEDVGANVSF SSIGSSNGIE GDHMFVFQKQ ETSLEAKRKH LLALLQMVDD QYSQCLDEIH  120
TVTSAFHAVT ELEPNLHARF VLPTISFMYK SLRERISSHV LAIGAHLKEG EARENKSFEA  180
CFIQKQWALQ QLSKRDHQLW RPQRGLPETS VSVLRTWMFQ NFLHPYPKDS EKHLLALKSG  240
LTRNQVSNWF INARVRLWKP MIEEMCAEMN RRKARKEDEE MEGNHRNQMR FETRRFTRD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-15206264563Homeobox protein Meis2
3k2a_B8e-15206264563Homeobox protein Meis2
4xrm_A8e-15206264563Homeobox protein Meis2
4xrm_B8e-15206264563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096864.11e-146PREDICTED: homeobox protein ATH1 isoform X1
SwissprotP487311e-101ATH1_ARATH; Homeobox protein ATH1
TrEMBLS8CT001e-120S8CT00_9LAMI; Uncharacterized protein (Fragment)
TrEMBLA0A022Q1E41e-119A0A022Q1E4_ERYGU; Uncharacterized protein
TrEMBLA0A068UKX61e-118A0A068UKX6_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000769951e-115(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-102homeobox gene 1